Involved in the biosynthesis of the coenzyme M (2-mercaptoethanesulfonic acid). Catalyzes the decarboxylation of sulfopyruvate to sulfoacetaldehyde. 3-sulfopyruvate + H+ = CO2 + sulfoacetaldehyde.

MKVDSSEAVYAGMKDAGIDFAVSVPCVNLRTVLEMVDADPAIMHVPVTREEEGFGVAAGA HMAGKTTAILMQNSGLGNSVNVLASLYSLYHIPITMIVSHRGTEGEFMEAQVPMGRATGD ILRILEIPFRTPRSPAEARESIGELTDISLRTSKAVAVLLDVSYW167

	10940029	Identification of the gene encoding sulfopyruvate decarboxylase, an enzyme involved in biosynthesis of coenzyme M.Graupner M, Xu H, White RH	The products of two adjacent genes in the chromosome of Methanococcus jannaschii are similar to the amino and carboxyl halves of phosphonopyruvate decarboxylase, the enzyme that catalyzes the second step of fosfomycin biosynthesis in Streptomyces wedmorensis. These two M. jannaschii genes were recombinantly expressed in Escherichia coli, and their gene products were tested for the ability to catalyze the decarboxylation of a series of alpha-ketoacids. Both subunits are required to form an alpha(6)beta(6) dodecamer that specifically catalyzes the decarboxylation of sulfopyruvic acid to sulfoacetaldehyde. This transformation is the fourth step in the biosynthesis of coenzyme M, a crucial cofactor in methanogenesis and aliphatic alkene metabolism. The M. jannaschii sulfopyruvate decarboxylase was found to be inactivated by oxygen and reactivated by reduction with dithionite. The two subunits, designated ComD and ComE, comprise the first enzyme for the biosynthesis of coenzyme M to be described.	2000
0	19581363	Bifurcated degradative pathway of 3-sulfolactate in Roseovarius nubinhibens ISM via sulfoacetaldehyde acetyltransferase and (S)-cysteate sulfolyase.Denger K, Mayer J, Buhmann M, Weinitschke S, Smits TH, Cook AM	Bifurcated degradative pathway of 3-sulfolactate in Roseovarius nubinhibens ISM via sulfoacetaldehyde acetyltransferase and (S)-cysteate sulfolyase	2009

Denger K, Mayer J, Buhmann M, et al. Bifurcated Degradative Pathway of 3-Sulfolactate in Roseovarius nubinhibens ISM via Sulfoacetaldehyde Acetyltransferase and (S)-Cysteate Sulfolyase[J]. Journal of Bacteriology, 2009, 191(18):5648-56. Graupner M , Xu H , White R H . Identification of the Gene Encoding Sulfopyruvate Decarboxylase, an Enzyme Involved in Biosynthesis of Coenzyme M[J]. Journal of Bacteriology, 2000, 182(17):4862-4867.