Name | RDL | ||||||||||
Function |
glutathione + thiosulfate = H+ + S-sulfanylglutathione + sulfite.
|
||||||||||
Definition | sulfurtransferase | ||||||||||
AA seq |
MWKAVMNAWNGTESQSKNVSNIQSYSFEDMKRIVGKHDPNVVLVDVREPSEYSIVHIPAS
INVPYRSHPDAFALDPLEFEKQIGIPKPDSAKELIFYCASGKRGGEAQKVASSHGYSNTS
LYPGSMNDWVSHGGDKLDL141
|
||||||||||
Structure | |||||||||||
Reference |
Melideo S L , Jackson M R , Jorns M S . Biosynthesis of a Central Intermediate in Hydrogen Sulfide Metabolism by a Novel Human Sulfurtransferase and Its Yeast Ortholog[J]. Biochemistry, 2014, 53(28):4739-4753. |
Guangxi Research Center for Microbial and Enzyme Engineering Technology, College of Life Science and Technology, Guangxi University
The Functional Genomics Research Team for The Subtropical Marine Mangrove Wetland Microorganisms.
Copyright (C) 2020 All Rights Reserved.