Catalytic subunit of the adenylylsulfate reductase which catalyzes reversibly the reduction of adenosine 5'-phosphosulfate (APS) to sulfite and AMP during dissimilatory sulfate reduction.
MPKIPSKETPRGVAIAEPIIVEHSVDLLMVGGGMGNCGAAFEAVRWADKYAPEAKILLVD
KASLERSGAVAQGLSAINTYLGDNNADDYVRMVRTDLMGLVREDLIYDLGRHVDDSVHLF
EEWGLPVWIKDEHGHNLDGAQAKAAGKSLRNGDKPVRSGRWQIMINGESYKVIVAEAAKN
ALGQDRIIERIFIVKLLLDKNTPNRIAGAVGFNLRANEVHIFKANAMVVACGGAVNVYRP
RSVGEGMGRAWYPVWNAGSTYTMCAQVGAEMTMMENRFVPARFKDGYGPVGAWFLLFKAK
ATNCKGEDYCATNRAMLKPYEERGYAKGHVIPTCLRNHMMLREMREGRGPIYMDTKTALQ
TSFATMSPAQQKHLEAEAWEDFLDMCVGQANLWAATNCAPEERGSEIMPTEPYLLGSHSG
CCGIWASGPDEAWVPEDYKVRAANGKVYNRMTTVEGLWTCADGVGASGHKFSSGSHAEGR
IVGKQMVRWYLDHKDFKPEFVETAEELKTLIYRPYYNYEKGKGASTCPVVNPEYISPKNF
MMRLIKCTDEYGGGVGTYYNTSKALLDTGFWLMEMLEEDSLKLAARDLHELLRCWENYHR
LWTVRLHMQHIAFREESRYPGFYYRADFLGLDDSKWKCFVNSKYDPAKKETKIFKKPYYQ
IIPTDA
678
| PMID | Title & Author | Abstract | Year | |
| 0 | 27824124 | Identity of major sulfur-cycle prokaryotes in freshwater lake ecosystems revealed by a comprehensive phylogenetic study of the dissimilatory adenylylsulfate reductase.Tomohiro Watanabe, Hisaya Kojima , Manabu Fukui | Adenylylsulfate reductase is a heterodimeric complex of two subunits, AprB and AprA, and is a key enzyme in dissimilatory sulfate reduction and sulfur oxidation. Common use of aprA as a functional marker gene has revealed the diversity of sulfur-cycle prokaryotes in diverse environments. In this study, we established a comprehensive sequence set of apr genes and employed it to reanalyze apr phylogeny, evaluate the coverage of a widely used primer set (AprA-1-FW/AprA-5-RV), and categorize environmental aprA sequences. Phylogenetic tree construction revealed new members of Apr lineage II and several previously unrecognized lateral gene transfer events. Using the established phylogenetic tree, we classified all previously reported aprA sequences amplified from freshwater lakes with the primer pair AprA-1-FW/AprA-5-RV in addition to the aprA sequences newly retrieved from freshwater lakes; the obtained results were complemented by 16S rRNA clone library analysis. Apr-based classifications of some of operational taxonomic units were supported by 16S rRNA-based analysis. This study updates our knowledge on the phylogeny of aprBA and shows the identities of several sulfur-cycle bacteria, which could not be classified to a known taxa until now. The established apr sequence set is publicly available and can be applied to assign environmental sequences to known lineages. | 2016 |
| 1 | 25034383 | Vertical distribution of major sulfate-reducing bacteria in a shallow eutrophic meromictic lake | The vertical distribution of sulfate-reducing bacteria was investigated in a shallow, eutrophic, meromictic lake, Lake Harutori, located in a residential area of Kushiro, Japan. A steep chemocline, characterized by gradients of oxygen, sulfide and salinity, was found at a depth of 3.5-4.0 m. The sulfide concentration at the bottom of the lake was high (up to a concentration of 10.7 mM). Clone libraries were constructed using the aprA gene, which encodes adenosine-5'-phosphosulfate reductase subunit A, in order to monitor sulfate-reducing bacteria. In the aprA clone libraries, the most abundant sequences were those from the Desulfosarcina-Desulfococcus (DSS) group. A primer set for a DSS group-specific 16S rRNA gene was used to construct another clone library, analysis of which revealed that the uncultured group of sulfate-reducing bacteria, SEEP SRB-1, accounted for nearly half of the obtained sequences. Quantification of the major bacterial groups by catalyzed reporter deposition-fluorescence in situ hybridization demonstrated that the DSS group accounted for 3.2-4.8% of the total bacterial community below the chemocline. The results suggested that the DSS group was one of the major groups of sulfate-reducing bacteria and that these presumably metabolically versatile bacteria might play an important role in sulfur cycling in Lake Harutori. | 2014 |
| 2 | 26156553 | Phylogenetic Diversity of aprA Genes in Subseafloor Sediments on the Northwestern Pacific Margin off Japan | Markedly diverse sequences of the adenosine-5'-phosphosulfate reductase alpha subunit gene (aprA), which encodes a key enzyme in microbial sulfate reduction and sulfur oxidation, were detected in subseafloor sediments on the northwestern Pacific off Japan. The aprA gene sequences were grouped into 135 operational taxonomic units (90% sequence identity), including genes related to putative sulfur-oxidizing bacteria predominantly detected in sulfate-depleted deep sediments. Our results suggest that microbial ecosystems in the subseafloor biosphere have phylogenetically diverse genetic potentials to mediate cryptic sulfur cycles in sediments, even where sulfate is rarely present. | 2015 |
Chiang Y L , Hsieh Y C , Fang J Y , et al. Crystal Structure of Adenylylsulfate Reductase from Desulfovibrio gigas Suggests a Potential Self-Regulation Mechanism Involving the C Terminus of the ?-Subunit[J]. Journal of Bacteriology, 2009, 191(24):7597-7608.