Electron transfer subunit of the dehydrogenase during anaerobic growth on dimethyl sulfide.

MVKRQISMVLDLNKCIGCQTCTSACKLQWTNRNGREYMYWNNVETHPGPGYPRNYEHSGG GFDEEGALKIGITPSAEDYGIPWEYNYEEALMTGTDPWLRPNVKPTWGANWNEDEGRGEY PNSYYFYLPRICNHCANPGCLAACARNAIYKRQEDGIVLVDQERCRGYRYCITACPYKKV YFNEQISKAEKCIFCYPRIEKGLPTACAKQCVGRIRFIGYLDDEAGPVHLLVERYKVAIP LHPEWGTKPSVFYVPPLAPPRIGDDGEPTEETRVPLAYLKELFGEAVVPALETLKTERAK KQSGAESELMDTLIGYRHPEMFKLS 331

	PMID	Title & Author	Abstract	Year
0	12067345	Molecular analysis of dimethyl sulphide dehydrogenase from Rhodovulum sulfidophilum: its place in the dimethyl sulphoxide reductase family of microbial molybdopterin-containing enzymes. Christopher A McDevitt , Philip Hugenholtz, Graeme R Hanson, Alastair G McEwan	Dimethyl sulphide dehydrogenase catalyses the oxidation of dimethyl sulphide to dimethyl sulphoxide (DMSO) during photoautotrophic growth of Rhodovulum sulfidophilum. Dimethyl sulphide dehydrogenase was shown to contain bis(molybdopterin guanine dinucleotide)Mo, the form of the pterin molybdenum cofactor unique to enzymes of the DMSO reductase family. Sequence analysis of the ddh gene cluster showed that the ddhA gene encodes a polypeptide with highest sequence similarity to the molybdopterin-containing subunits of selenate reductase, ethylbenzene dehydrogenase. These polypeptides form a distinct clade within the DMSO reductase family. Further sequence analysis of the ddh gene cluster identified three genes, ddhB, ddhD and ddhC. DdhB showed sequence homology to NarH, suggesting that it contains multiple iron-sulphur clusters. Analysis of the N-terminal signal sequence of DdhA suggests that it is secreted via the Tat secretory system in complex with DdhB, whereas DdhC is probably secreted via a Sec-dependent mechanism. Analysis of a ddhA mutant showed that dimethyl sulphide dehydrogenase was essential for photolithotrophic growth of Rv. sulfidophilum on dimethyl sulphide but not for chemo-trophic growth on the same substrate. Mutational analysis showed that cytochrome c2 mediated photosynthetic electron transfer from dimethyl sulphide dehydrogenase to the photochemical reaction centre, although this cytochrome was not essential for photoheterotrophic growth of the bacterium.	2002
1	12957948	A gene cluster for chlorate metabolism in Ideonella dechloratans. Helena Danielsson Thorell , Katarina Stenklo, Jan Karlsson, Thomas Nilsson	Chlorate reductase has been isolated from the chlorate-respiring bacterium Ideonella dechloratans, and the genes encoding the enzyme have been sequenced. The enzyme is composed of three different subunits and contains molybdopterin, iron, probably in iron-sulfur clusters, and heme b. The genes (clr) encoding chlorate reductase are arranged as clrABDC, where clrA, clrB, and clrC encode the subunits and clrD encodes a specific chaperone. Judging from the subunit composition, cofactor content, and sequence comparisons, chlorate reductase belongs to class II of the dimethyl sulfoxide reductase family. The clr genes are preceded by a novel insertion sequence (transposase gene surrounded by inverted repeats), denoted ISIde1. Further upstream, we find the previously characterized gene for chlorite dismutase (cld), oriented in the opposite direction. Chlorate metabolism in I. dechloratans starts with the reduction of chlorate, which is followed by the decomposition of the resulting chlorite to chloride and molecular oxygen. The present work reveals that the genes encoding the enzymes catalyzing both these reactions are in close proximity.	2003

Thorell H D , Stenklo K , Karlsson J , et al. A gene cluster for chlorate metabolism in Ideonella dechloratans[J]. Applied & Environmental Microbiology, 2003, 69(9):5585.