Name | dsrF | |||||
Function |
Sulfurtransferase.
|
|||||
Definition | Sulfurtransferase | |||||
AA seq |
MKRVAFVFTHAPHGNASGREGLDALLAVSALTEEIGVFFVGDGVLQLLPQQQPDQILMRN
YIATFGVLPLYDIDCCYLCETSVRQRGLSIDTNWVLDVELLAPEAWRSKLASYHSILSF120
|
|||||
Structure | ||||||
Reference |
Stockdreher, Y., Sturm, M., Josten, M., Sahl, H.G., Dobler, N., Zigann, R., and Dahl, C. (2014) New proteins involved in sulfur trafficking in the cytoplasm of Allochromatium vinosum. J Biol Chem 289: 12390–12403. |
Guangxi Research Center for Microbial and Enzyme Engineering Technology, College of Life Science and Technology, Guangxi University
The Functional Genomics Research Team for The Subtropical Marine Mangrove Wetland Microorganisms.
Copyright (C) 2020 All Rights Reserved.