[DsrC]‐trisulfide → hydrogen sulfide + [DsrC protein]‐dithiol + 2 electron‐transfer quinone.

MSQETFTAPQVPEDPQDLLTPPNQPGARADSRPHMASAEHQEALDFPGALPSNWQDIALE HFEKLLERSRSLRVYLDSCVRCGACTDKCHFYLGTGDPKNMPAARQDLLRDVYRRHFTPA GRNFPGLVRGRELTKEVLDEWFVYFHQCSQCRRCSVFCPYGIDTAELSMAARELLDAVGY GQKYTNEIIGKVHKIGNNLGLPGPALEDTLEGLEEDLKDDTGHDIRIPLDEEGADILLVT PSADFFAEPHVDGLMGYAKVFHQAGLSWTLSSYASEAANFGMFIGNYEQMRAIAARIRKA AVDLGVKRIVIGECGHAWRVAYSFWNTLVGIGQGAAEDDEYARALQDQLDPNYPIPQHIC ELTADLLESGALHLDPSANEHYGGVTFHDSCNVARASRMGARPGGQFEIPRRLLRASVPR FYEMAPGTTGDATFCCGGGGGLLTDELIELRVQGALPRVSALRESMETYGVDRMVAICAI CKAQFTKVLPYYDIPRDTVMSLHEAVGNAVRLDRGEG525

	PMID	Title & Author	Abstract	Year
0	10556728	Genes involved in hydrogen and sulfur metabolism in phototrophic sulfur bacteria.C Dahl , G Rákhely, A S Pott-Sperling, B Fodor, M Takács, A Tóth, M Kraeling, K Gy"orfi, A Kovács, J Tusz, K L Kovács	The dsr genes and the hydSL operon are present as separate entities in phototrophic sulfur oxidizers of the genera Allochromatium, Marichromatium, Thiocapsa and Thiocystis and are organized similarly as in Allochromatium vinosum and Thiocapsa roseopersicina, respectively. The dsrA gene, encoding the alpha subunit of 'reverse' siroheme sulfite reductase, is also present in two species of green sulfur bacteria pointing to an important and universal role of this enzyme and probably other proteins encoded in the dsr locus in the oxidation of stored sulfur by phototrophic bacteria. The hupSL genes are uniformly present in the members of the Chromatiaceae family tested. The two genes between hydS and hydL encode a membrane-bound b-type cytochrome and a soluble iron-sulfur protein, respectively, resembling subunits of heterodisulfide reductase from methanogenic archaea. These genes are similar but not identical to dsrM and dsrK, indicating that the derived proteins have distinct functions, the former in hydrogen metabolism and the latter in oxidative sulfur metabolism.	1999
1	21132364	Ferric iron uptake genes are differentially expressed in the presence of copper sulfides in Acidithiobacillus ferrooxidans strain LR.Lúcio F C Ferraz , Leandro C L Verde, Renato Vicentini, Ana P Felício, Marcelo L Ribeiro, Fabiana Alexandrino, Maria T M Novo, Oswaldo Garcia Jr, Daniel J Rigden, Laura M M Ottoboni	Acidithiobacillus ferrooxidans is one of the most widely used microorganisms in bioleaching operations to recover copper from low-grade copper sulfide ores. This work aimed to investigate the relative expression of genes related to the iron uptake system when A. ferrooxidans LR was maintained in contact with chalcopyrite or bornite as the sole energy source. Real-time quantitative PCR analysis revealed that the presence of bornite had no effect on the expression of seven genes related to the siderophore-mediated Fe(III) uptake system, while in the presence of chalcopyrite the expression of the genes was up-regulated. Bioinformatic analysis of the genomic region where these genes were found revealed the existence of three new putative DNA-binding sequences for the ferric iron uptake transcriptional regulator (Fur). Electrophoretic mobility shift assays demonstrated that a purified A. ferrooxidans His-tagged Fur protein was able to bind in vitro to each of these putative Fur boxes, suggesting that Fur regulated the expression of these genes. The expression of fur and two known Fur-regulated genes, mntH and dsrK, was also investigated in the presence of chalcopyrite. While the expression of fur and mntH was up-regulated, the expression of dsrK was down-regulated. The low amount of ferrous iron in the medium was probably responsible for the up-regulation of fur and the genes related to the siderophore-mediated Fe(III) uptake system when A. ferrooxidans LR was kept in the presence of chalcopyrite. A homology model of the A. ferrooxidans Fur was constructed and revealed that the putative DNA-binding surface presents conserved positively charged residues, supporting a previously suggested mode of interaction with DNA. The up-regulation of fur and the siderophore-mediated Fe(III) uptake genes, and the down-regulation of dsrK suggest that in the presence of chalcopyrite Fur acts as a transcription inducer and repressor.	2011
2	20952577	Biochemical characterization of individual components of the Allochromatium vinosum DsrMKJOP transmembrane complex aids understanding of complex function in vivo.Fabian Grein , Inês A C Pereira, Christiane Dahl	The DsrMKJOP transmembrane complex has a most important function in dissimilatory sulfur metabolism and consists of cytoplasmic, periplasmic, and membrane integral proteins carrying FeS centers and b- and c-type cytochromes as cofactors. In this study, the complex was isolated from the purple sulfur bacterium Allochromatium vinosum and individual components were characterized as recombinant proteins. The two integral membrane proteins DsrM and DsrP were successfully produced in Escherichia coli C43(DE3) and C41(DE3), respectively. DsrM was identified as a diheme cytochrome b, and the two hemes were found to be in low-spin state. Their midpoint redox potentials were determined to be +60 and +110 mV. Although no hemes were predicted for DsrP, it was also clearly identified as a b-type cytochrome. To the best of our knowledge, this is the first time that heme binding has been experimentally proven for a member of the NrfD protein family. Both cytochromes were partly reduced after addition of a menaquinol analogue, suggesting interaction with quinones in vivo. DsrO and DsrK were both experimentally proven to be FeS-containing proteins. In addition, DsrK was shown to be membrane associated, and we propose a monotopic membrane anchoring for this protein. Coelution assays provide support for the proposed interaction of DsrK with the soluble cytoplasmic protein DsrC, which might be its substrate. A model for the function of DsrMKJOP in the purple sulfur bacterium A. vinosum is presented.	2010

Grein, F., Pereira, I.A., and Dahl, C. (2010) Biochemical characterization of individual components of the Allochromatium vinosum DsrMKJOP transmembrane complex aids understanding of complex function in vivo. J Bacteriol 192: 6369–6377.