| Name | psrB | ||||||||||
| Function |
Component of the phosphorylative electron transport system with polysulfide as the terminal acceptor.
|
||||||||||
| Definition | polysulfide reductase chain B | ||||||||||
| AA seq |
MAKKYGMIHDENLCIGCQACNIACRSENKIPDSVYRLQVWVQGPKKLPDGTLSFNYHRQS
CVQCENTPCVSVCPTKASYVNEDGIVSVNVDLCVGCLYCIAACPYQARYVDPVTKAPDKC
NFCKDTRLARGEEPACVTVCPTDALTFGDMSDPKSKINKVLASKPTLRPKESLGTKPKLF
IVPNKRGGIES194
|
||||||||||
| Structure |
|
||||||||||
| Reference |
Krafft T , Gross R , Achim Kröger. The Function of Wolinella succinogenes psr Genes in Electron Transport with Polysulphide as the Terminal Electron Acceptor[J]. European Journal of Biochemistry, 1995, 230. |
Guangxi Research Center for Microbial and Enzyme Engineering Technology, College of Life Science and Technology, Guangxi University
The Functional Genomics Research Team for The Subtropical Marine Mangrove Wetland Microorganisms.
Copyright (C) 2020 All Rights Reserved.