Sulfur reductase.
MTDNPYLAFGNNRSCKNWGFVVRVDQCLGCMACMAACAVENQTPFWEELWRTHVEDLEVG
EFPNSQRMFIPRLCMQCENPPCYYVCPTGATQIVDGGIVVVDEYKCMGCLYCVEACPYGA
RYFYTYDDIQKAKEYYGDNLIHVVPHVDKCTFCYGTAPDGTYTPACVRTCVGGARVFGCL
DDPNSEVSVLVNTGQAVVLNPQLNVQPKVFYVFNKQSGRYAQGGDNS
231
| PMID | Title & Author | Abstract | Year | |
| 0 | 19914169 | A trans-acting riboswitch controls expression of the virulence regulator PrfA in Listeria monocytogenes. Edmund Loh , Olivier Dussurget, Jonas Gripenland, Karolis Vaitkevicius, Teresa Tiensuu, Pierre Mandin, Francis Repoila, Carmen Buchrieser, Pascale Cossart, Jörgen Johansson | Riboswitches are RNA elements acting in cis, controlling expression of their downstream genes through a metabolite-induced alteration of their secondary structure. Here, we demonstrate that two S-adenosylmethionine (SAM) riboswitches, SreA and SreB, can also function in trans and act as noncoding RNAs in Listeria monocytogenes. SreA and SreB control expression of the virulence regulator PrfA by binding to the 5'-untranslated region of its mRNA. Absence of the SAM riboswitches SreA and SreB increases the level of PrfA and virulence gene expression in L. monocytogenes. Thus, the impact of the SAM riboswitches on PrfA expression highlights a link between bacterial virulence and nutrient availability. Together, our results uncover an unexpected role for riboswitches and a distinct class of regulatory noncoding RNAs in bacteria. | 2009 |
| 1 | 12949162 | Membrane-bound hydrogenase and sulfur reductase of the hyperthermophilic and acidophilic archaeon Acidianus ambivalens. Simone Laska , Friedrich Lottspeich , Arnulf Kletzin | A sulfur reductase (SR) and a hydrogenase were purified from solubilized membrane fractions of anaerobically grown cells of the sulfur-dependent archaeon Acidianus ambivalens and the corresponding genes were sequenced. The SR reduced elemental sulfur with hydrogen as electron donor [45 U (mg protein)(-1)] in the presence of hydrogenase and either 2,3-dimethylnaphthoquinone (DMN) or cytochrome c in the enzyme assay. The SR could not be separated from the hydrogenase during purification without loss of activity, whereas the hydrogenase could be separated from the SR. The specific activity of the hydrogenase was 170 U (mg protein)(-1) with methyl viologen and 833 U (mg protein)(-1) with DMN as electron acceptors. Both holoenzymes showed molecular masses of 250 kDa. In SDS gels of active fractions, protein bands with apparent masses of 110 (SreA), 66 (HynL), 41 (HynS) and 29 kDa were present. Enriched hydrogenase fractions contained 14 micro mol Fe and 2 micromol Ni (g protein)(-1); in addition, 2.5 micromol Mo (g protein)(-1) was found in the membrane fraction. Two overlapping genomic cosmid clones were sequenced, encoding a five-gene SR cluster (sre) including the 110 kDa subunit gene (sreA), and a 12-gene hydrogenase cluster (hyn) including the large and small subunit genes and genes encoding proteins required for the maturation of NiFe hydrogenases. A phylogenetic analysis of the SR amino acid sequence revealed that the protein belonged to the DMSO reductase family of molybdoenzymes and that the family showed a novel clustering. A model of sulfur respiration in Acidianus developed from the biochemical results and the data of the amino acid sequence comparisons is discussed. | 2003 |
Laska S , Lottspeich F , Kletzin A . Membrane-bound hydrogenase and sulfur reductase of the hyperthermophilic and acidophilic archaeon Acidianus ambivalens[J]. Microbiology, 2003, 149(Pt 9):2357-2371.